Exenatide
peptide · headlineFDA-approvedEnhances glucose-dependent insulin secretion
Overview
Exenatide is a GLP-1 receptor agonist approved for type 2 diabetes treatment. It mimics incretin hormones to stimulate insulin secretion in a glucose-dependent manner, suppresses glucagon, delays gastric emptying, and aids in weight reduction. Available in twice-daily and weekly extended-release formulations, it also shows potential benefits in hepatic fat reduction and neuroprotection.
How it works
- Enhances glucose-dependent insulin secretion
- Suppresses inappropriately elevated glucagon secretion
- Slows gastric emptying and reduces postprandial glucose spikes
Dosing
Start with 5 mcg SubQ twice daily before meals; increase to 10 mcg if tolerated. For extended-release, 2 mg once weekly.
Caution: Do not exceed 10mcg twice daily. Common side effects include nausea, which typically diminishes with continued use. Pancreatitis risk exists; discontinue immediately if severe abdominal pain occurs.
Cycling
- Immediate-release: Inject twice daily within 60 minutes before morning and evening meals. Extended-release: Inject 2 mg SubQ once weekly. Continuous use; monitor glucose, A1c, and GI tolerance.
Side effects
- Common
- Nausea
- Vomiting
- Diarrhea
- Warnings
- Risk of acute pancreatitis
- Caution in patients with renal impairment
- Long Term
- Potential risk of thyroid C-cell tumors (observed in rodents)
Stacking & combinations
- With
Semaglutide
- Benefit
Both GLP-1 agonists; combined use may enhance weight loss and metabolic effects
- With
Tirzepatide
- Benefit
GLP-1/GIP agonist combination; complementary mechanism for enhanced glucose control
- With
AOD-9604
- Benefit
Fat-loss peptide; stacks with Exenatide for enhanced body composition improvements
Lifestyle support
- Diet
Maintain caloric deficit of 300–500 calories. Lean proteins, vegetables, complex carbohydrates. Stay hydrated with 2–3 liters water daily.
- Sleep
Adequate sleep for metabolic recovery.
- Timing
Inject 60 minutes before meals. Consistent timing daily.
- Exercise
Regular exercise 4–5 times weekly (both cardio and resistance).
Research studies
Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.
Exenatide once weekly versus placebo in Parkinson's disease: a randomised, double-blind, placebo-controlled trial
Athauda D, Maclagan K, Skene SS, Bajwa-Joseph M, Letchford D, Chowdhury K, Hibbert S, Budnik N, Zampedri L, Dickson J, Li Y, Aviles-Olmos I, Warner TT, Limousin P, Lees AJ, Greig NH, Tebbs S, Foltynie T Lancet. 2017 Oct 7;390(10103):1664-1675 View source ↗
In this double-blind, placebo-controlled trial, 62 patients with moderate Parkinson's disease were randomised to subcutaneous exenatide 2 mg once weekly or placebo for 48 weeks, followed by a 12-week washout. The primary endpoint, the adjusted difference in practically defined off-medication MDS-UPDRS Part 3 motor score at 60 weeks, favoured exenatide by 3.5 points (95% CI -6.7 to -0.3; p=0.0318), with the exenatide group showing a +1.0-point improvement versus a -2.1-point decline on placebo. Because the motor advantage persisted after the 12-week washout, when exenatide would have been cleared, the authors raised the possibility of a disease-modifying rather than purely symptomatic effect, though they cautioned this required confirmation.
Researchers tested a diabetes drug, exenatide, given as a weekly injection, in 62 people with Parkinson's disease over roughly a year. People on exenatide had modestly better movement scores than those on dummy injections, and the benefit lasted even after they stopped the drug for 12 weeks. This hinted the drug might slow the disease itself rather than just mask symptoms, but larger studies were needed to be sure.
Exenatide and the treatment of patients with Parkinson's disease
Aviles-Olmos I, Dickson J, Kefalopoulou Z, Djamshidian A, Ell P, Soderlund T, Whitton P, Wyse R, Isaacs T, Lees A, Limousin P, Foltynie T Journal of Clinical Investigation. 2013 Jun;123(6):2730-6 View source ↗
This single-blind, controlled proof-of-concept study assigned 45 patients with moderate Parkinson's disease to either exenatide 5 microg twice daily (later 10 microg) subcutaneously for 12 months or to act as controls, all continuing conventional therapy. Exenatide-treated patients showed a mean improvement of 2.7 points on the MDS-UPDRS at 12 months versus a mean decline of 2.2 points in controls (p=0.037), with parallel advantages on cognitive testing (Mattis Dementia Rating Scale). The benefits, though the trial was open-label and small, provided the first clinical signal supporting the neuroprotective/neurorestorative effects of GLP-1 receptor agonism observed in preclinical models and motivated the subsequent double-blind trial.
This early study gave exenatide to 45 people with Parkinson's disease for a year and compared them with untreated patients. Those on the drug improved slightly on movement and thinking tests, while the comparison group got worse. Because it was a small, non-blinded study the findings were preliminary, but they were encouraging enough to justify a rigorous follow-up trial.
Effects of exenatide (exendin-4) on glycemic control and weight over 30 weeks in metformin-treated patients with type 2 diabetes
DeFronzo RA, Ratner RE, Han J, Kim DD, Fineman MS, Baron AD Diabetes Care. 2005 May;28(5):1092-100 View source ↗
This triple-blind, placebo-controlled 30-week trial randomised 336 patients with type 2 diabetes inadequately controlled on metformin to placebo or exenatide 5 or 10 microg twice daily. Exenatide 10 microg reduced HbA1c by 0.78% versus placebo (placebo essentially unchanged), and 46% of the high-dose group reached HbA1c <=7% versus 13% on placebo. Exenatide also produced dose-dependent, progressive weight loss (approximately 2.8 kg with the 10 microg dose) with no increase in hypoglycaemia; mild-to-moderate nausea was the most common adverse effect.
In people with type 2 diabetes whose blood sugar was not well controlled by metformin alone, adding twice-daily exenatide injections meaningfully lowered long-term blood sugar (HbA1c) compared with placebo. Patients also lost weight rather than gaining it, which is unusual for diabetes drugs, and did not have more episodes of dangerously low blood sugar. The main side effect was mild-to-moderate nausea.
Verified citations
2 · PubMed-checked- Exenatide.reviewPMID 16341288 ↗
- A Pilot Study of Exenatide Actions in Alzheimer's Disease.clinicalPMID 31518224 ↗
Reconstitution calculator
Subcutaneous (SQ)= 0.001 mL on a U-100 insulin syringe
Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2–8°C after reconstitution. Use within 28 days.
Chemistry & PK
- Sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- Half Life
- 2.4 hours (immediate-release); approximately 6 to 7 days (extended-release).
- Degradation
- Primarily degraded by DPP-4 enzyme and cleared renally.
- Molecular Weight
- 4186.6
- Molecular Formula
- C184H282N50O60
- Tissue Specificity
- Targets pancreatic beta cells, central appetite centers, and slows gastric emptying.
Bioavailability
- Oral
- Not available as an oral tablet; low oral bioavailability.
- Subq
- Good bioavailability via subcutaneous injection.
Storage & handling
- Lyophilized
Store pens at 2-8°C before first use. After initial use, may be stored at room temperature (15-30°C) for up to 30 days. Never freeze. Protect from light.
- Reconstituted
Refrigerate at 2–8°C after reconstitution. Use within 28 days.
Legal / compounding
- EU
- Approved
- FDA
- Approved
- Canada
- Approved
- Australia
- Approved
Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.