LL-37
peptide · headlineResearch use onlyDisrupts microbial membranes via pore formation
Overview
LL-37 is a naturally occurring antimicrobial peptide in the cathelicidin family, integral to innate immune defense. It exerts antimicrobial, immunomodulatory, and wound-healing effects through membrane disruption, immune activation, and epithelial regeneration. Its applications span infectious disease, chronic wounds, and immune regulation.
How it works
- Disrupts microbial membranes via pore formation
- Neutralizes endotoxins such as lipopolysaccharides (LPS)
- Activates chemokine and cytokine signaling for immune cell recruitment
- Regulates toll-like receptor signaling pathways in epithelial and immune cells
Dosing
200 mcg SubQ daily or topical application 1–2x daily to affected site. Research-based; clinical protocols still under development.
Caution: Research doses range from 1–5 μg/mL in vitro, or 1–10 mg/kg in animal models. LL-37 is not approved for use outside of the laboratory.
Cycling
- 200–400 mcg daily or every other day for 4–6 weeks. Repeat cycles as needed with immune monitoring.
- Apply to affected area once or twice daily. Safe for use in infected wounds, burns, or epithelial inflammation.
Side effects
Stacking & combinations
- With
BPC-157
- Benefit
Enhanced epithelial healing and immune priming
- With
KPV
- Benefit
Synergistic anti-inflammatory and mucosal protection
- With
Thymosin Alpha-1
- Benefit
Complementary antiviral and immune-enhancing effects
Lifestyle support
- Diet
Optimize vitamin D status (upregulates endogenous LL-37). Adequate protein, zinc, and vitamin C for wound healing.
- Sleep
Adequate sleep and stress management.
- Timing
Consistent injection schedule during active infection or wound healing.
- Exercise
Moderate activity as tolerated. Proper wound hygiene.
Research studies
Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.
In vitro and in vivo wound healing-promoting activities of human cathelicidin LL-37
Carretero M, Escámez MJ, García M, Duarte B, Holguín A, Retamosa L, Jorcano JL, Río MD, Larcher F Journal of Investigative Dermatology. 2008 Jan;128(1):223-36 View source ↗
This mechanistic study showed that LL-37 activates migration of human HaCaT keratinocytes in vitro, driving actin cytoskeleton reorganization and increased tyrosine phosphorylation of proteins in focal adhesion complexes. Using adenoviral gene transfer of LL-37 to full-thickness excisional wounds in diabetic, healing-impaired ob/ob mice, the peptide significantly enhanced re-epithelialization and granulation tissue formation in vivo. The work established that LL-37's benefit in wound repair is a direct pro-regenerative effect on host skin cells, distinct from its antimicrobial killing.
Beyond fighting germs, LL-37 helps skin heal. In lab dishes it prompted skin cells to move and close gaps, and in wounds on diabetic mice that normally heal poorly, delivering extra LL-37 sped up the regrowth of skin and healthy new tissue. This showed LL-37 actively helps the body rebuild wounded skin, not just keep it clean.
A comprehensive summary of LL-37, the factotum human cathelicidin peptide
Vandamme D, Landuyt B, Luyten W, Schoofs L Cellular Immunology. 2012 Nov;280(1):22-35 View source ↗
This peer-reviewed review synthesizes LL-37's dual role as a broad-spectrum, membrane-disrupting antimicrobial peptide and a multifunctional immunomodulator. It details how the cationic, amphipathic 37-residue peptide (cleaved from hCAP18) permeabilizes microbial membranes, neutralizes LPS/endotoxin, and inhibits biofilms, while also driving chemotaxis of neutrophils, monocytes and lymphocytes, modulating cytokine production, and promoting angiogenesis and wound healing. Being a review, it is mechanistic and integrative rather than reporting new primary experimental data.
This overview pulls together what is known about LL-37, a natural peptide our own immune cells make. It explains the two big jobs the peptide does: punching holes in bacteria to kill them, and acting as a signal that recruits and coordinates immune cells while helping tissues heal. It is a useful map of why this one small molecule matters across infection, inflammation and repair.
Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial
Mahlapuu M, Sidorowicz A, Mikosinski J, Krzyżanowski M, Orleanski J, Twardowska-Saucha K, Nykaza A, Dyaczynski M, Belz-Lagoda B, Dziwiszek G, Kujawiak M, Karczewski M, Sjöberg F, Grzela T, Wegrzynowski A, Thunarf F, Björk J, Ekblom J, Jawien A, Apelqvist J Wound Repair and Regeneration. 2021 Nov;29(6):938-950 View source ↗
This phase IIb double-blind, randomized, placebo-controlled clinical trial (HEAL LL-37) tested topical LL-37 (0.5 or 1.6 mg/mL) plus compression therapy in 148 patients with hard-to-heal venous leg ulcers. The primary efficacy analysis over the full population found no statistically significant improvement in healing versus placebo, though the 0.5 mg/mL dose showed a significant odds ratio (~3.25) for reaching 50% wound closure, and a post hoc analysis found significant benefit in patients with large wounds (>=10 cm2). Treatment was safe and well tolerated across doses.
This was a real human trial in patients with stubborn leg ulcers that will not heal. Applying LL-37 to the wound was safe, but overall it did not clearly beat placebo at healing the ulcers; hints of benefit appeared for partial wound closure and for the largest wounds. It shows the peptide is promising and safe but not yet a proven cure, which is why researchers are still refining the dose and target patients.
Verified citations
2 · PubMed-checked- LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity.reviewPMID 27117377 ↗
- Cathelicidin peptide LL-37: A multifunctional peptide involved in heart disease.reviewPMID 39615616 ↗
Reconstitution calculator
Subcutaneous (SQ)= 0.04 mL on a U-100 insulin syringe
Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2–8 °C (35.6–46.4 °F) for up to 4 weeks; frozen at −20 °C (−4 °F) for up to 6 months
Chemistry & PK
- Sequence
- LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- Half Life
- Short systemic half-life; effects are mostly local and transient
- Degradation
- Metabolized by tissue proteases and immune-related enzymes
- Molecular Weight
- 4493.3
- Molecular Formula
- C62H114N18O19
- Tissue Specificity
- Active in skin, lungs, oral cavity, GI tract, and mucosal surfaces
Bioavailability
- Oral
- Poor bioavailability due to rapid enzymatic breakdown
- Subq
- High when injected; effects mostly localized to immune and epithelial tissues
Storage & handling
- Lyophilized
freeze at −20 °C (−4 °F); after reconstitution, refrigerate at 2–8 °C (35.6–46.4 °F) for up to 4 weeks; avoid freeze–thaw cycles
- Reconstituted
Refrigerate at 2–8 °C (35.6–46.4 °F) for up to 4 weeks; frozen at −20 °C (−4 °F) for up to 6 months
Contraindication — Cationic peptides can worsen MCAS (MRGPRX2 degranulation)
LL-37, VIP/PACAP and full α-MSH degranulate human mast cells via MRGPRX2 — avoid in mast-cell patients. KPV is safe (NF-κB pathway).
Legal / compounding
- EU
- Not Approved
- FDA
- Not Approved
- Canada
- Not Approved
- Australia
- Not Approved
Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.