Pepacorn
← Compounds

Seractide/ACTH (1-39)

peptide · headlineFDA-approved

Binds to melanocortin 2 receptors (MC2R) on adrenal cortex cells

Overview

ACTH (1-39), also known as Seractide, is a full-length synthetic form of adrenocorticotropic hormone used to evaluate adrenal function in diagnostic testing. It mimics natural ACTH, triggering cortisol release from the adrenal cortex in response to hypothalamic or pituitary dysfunction.

How it works

  • Binds to melanocortin 2 receptors (MC2R) on adrenal cortex cells
  • Stimulates synthesis and release of cortisol and androgens
  • Mimics natural ACTH secretion patterns from the pituitary
  • Activates steroidogenic enzymes and cholesterol transport systems in adrenal cells

Dosing

0.25 mg IM or IV as a single dose for adrenal stimulation testing. Monitor cortisol response within 30–60 minutes.

Intramuscular (IM)0.25 mg standardrange 0.250.5 mg· Single administration for diagnostic testing
Intravenous (IV)0.25 mg standardrange 0.250.5 mg· Single administration for diagnostic testing

Caution: Diagnostic protocols typically use 250 μg IM or IV bolus. Use is limited to regulated medical settings.

Cycling

  • Used once in standard cosyntropin stimulation test; repeated use is rare unless clinically indicated.
  • Administered as a bolus IV push; cortisol levels are measured at 30–60 minutes post-injection.

Side effects

Common
  • Facial flushing
  • Mild hypertension
  • Nausea
  • Transient anxiety
Warnings
  • Caution in patients with uncontrolled hypertension or recent cardiovascular events
  • Avoid repeated dosing without endocrine supervision
Long Term
  • Prolonged use may lead to adrenal suppression, Cushingoid symptoms, or HPA axis disruption

Stacking & combinations

    Lifestyle support

    Diet

    Ensure adequate nutrition and electrolyte balance. ACTH affects cortisol and aldosterone.

    Sleep

    Monitor sleep quality as cortisol modulation may affect sleep patterns.

    Timing

    Morning administration recommended to align with cortisol rhythm.

    Exercise

    Moderate exercise recommended. Avoid overtraining as ACTH affects adrenal function.

    Research studies

    Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.

    Research study

    Influences of peripheral adrenocorticotropin 1-39 (ACTH) and human corticotropin releasing hormone (h-CRH) on human auditory evoked potentials (AEP)

    Born J, Bathelt B, Pietrowsky R, Pauschinger P, Fehm HL Psychopharmacology (Berl). 1990;101(1):34-38 View source ↗

    Scientific findings

    This is one of the few controlled human studies using full-length ACTH 1-39 (seractide) itself rather than the 1-24 fragment. Healthy men received IV bolus placebo, porcine ACTH 1-39 (1.5 U), or h-CRH, and cortical auditory evoked potentials were recorded. ACTH 1-39 produced central nervous system effects on evoked-potential components that differed from those of CRH, indicating that the intact 1-39 peptide exerts direct extra-adrenal (neuromodulatory) actions in humans independent of its classical adrenocortical cortisol-stimulating role.

    Plain English

    Unlike most ACTH research, which uses a shortened synthetic fragment, this study gave people the complete natural ACTH molecule (the 1-39 form). Researchers measured brain electrical responses to sounds and found that full-length ACTH changed how the brain processed sound, separate from its familiar job of telling the adrenal glands to make cortisol. It shows the whole hormone can act directly on the brain, not just on the adrenal glands.

    Research study

    One microgram is the lowest ACTH dose to cause a maximal cortisol response. There is no diurnal variation of cortisol response to submaximal ACTH stimulation

    Dickstein G, Spigel D, Arad E, Shechner C European Journal of Endocrinology. 1997;137(2):172-175 View source ↗

    Scientific findings

    In healthy volunteers, graded intravenous ACTH doses were used to define the dose-response relationship for adrenal cortisol secretion. A dose as low as 1 microgram produced a maximal cortisol response essentially equal to that of the conventional 250 microgram dose, establishing 1 microgram as the threshold for maximal adrenocortical stimulation. The cortisol response to submaximal ACTH did not vary by time of day, indicating adrenal sensitivity to ACTH is stable across the diurnal cycle.

    Plain English

    Doctors traditionally inject a large dose of ACTH to test whether the adrenal glands can make cortisol. This study showed that a tiny dose, one microgram, pushes the adrenal glands just as hard as the standard large dose. It also found the adrenal response is the same whether tested in the morning or later, which helped establish the modern 'low-dose' ACTH stimulation test.

    Research study

    ACTH Stimulation Tests for the Diagnosis of Adrenal Insufficiency: Systematic Review and Meta-Analysis

    Ospina NS, Al Nofal A, Bancos I, Javed A, Benkhadra K, Kapoor E, Lteif AN, Natt N, Murad MH The Journal of Clinical Endocrinology & Metabolism. 2016;101(2):427-434 View source ↗

    Scientific findings

    This meta-analysis pooled 30 studies (1209 adults and 228 children for secondary adrenal insufficiency, ~100 patients for primary) evaluating high-dose (250 microgram) and low-dose (1 microgram) ACTH stimulation tests. High- and low-dose tests had similar diagnostic accuracy, with generally low sensitivity and high specificity; positive likelihood ratios were favorable (adults: high dose 9.1, low dose 5.9) but negative likelihood ratios were suboptimal. For primary adrenal insufficiency the high-dose test sensitivity was 92% (95% CI 81-97%), whereas both tests performed less reliably for excluding mild secondary (central) adrenal insufficiency.

    Plain English

    This is a large review combining many studies of the ACTH stimulation test, the standard way to check if the adrenal glands are working. It found that both the high-dose and low-dose versions are good at confirming adrenal insufficiency when the test is abnormal, but a normal result does not fully rule out milder cases, especially when the problem originates in the pituitary. It gives clinicians a clear, evidence-based picture of what the test can and cannot tell them.

    Verified citations

    2 · PubMed-checked
    • Dose-response relationships between plasma ACTH, cortisol, aldosterone after injection of ACTH-(1-39) in man.clinicalPMID 2826525
    • Brain evoked responses, a bioassay for central actions of ACTH 1-39 in humans.mechanismPMID 1650750

    Reconstitution calculator

    Intramuscular (IM)
    Draw to5 units

    = 0.05 mL on a U-100 insulin syringe

    Concentration5 mg/mL
    Doses / vial40

    Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2-8°C. Use within 3-4 weeks.

    Chemistry & PK

    Sequence
    SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
    Half Life
    Approximately 15 minutes
    Degradation
    Cleared via protease metabolism and renal excretion
    Molecular Weight
    4541.05
    Molecular Formula
    C207H308N56O58S
    Tissue Specificity
    Targets adrenal cortex cells to trigger glucocorticoid synthesis

    Bioavailability

    Oral
    Poor due to peptide degradation in GI tract
    Subq
    Rarely used via this route due to preferred IV/IM kinetics

    Storage & handling

    Lyophilized

    Store lyophilized powder at -20°C for long-term or 2-8°C for short-term. Protect from light. Do not freeze reconstituted solution.

    Reconstituted

    Refrigerate at 2-8°C. Use within 3-4 weeks.

    Legal / compounding

    FDA-approved
    EU
    Approved
    FDA
    Approved
    Canada
    Approved
    Australia
    Approved

    Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.