Back to Peptides

IGF-1 LR3

Growth Factors & Muscle Building

IGF-1 LR3 is a long-acting analog of insulin-like growth factor-1 engineered for enhanced bioavailability and prolonged action. It binds IGF-1 receptors in muscle and bone to stimulate anabolic growth, repair, and recovery. It is studied for its role in cell proliferation, muscle growth, and tissue regeneration in animal models and in vitro systems.

Reconstitute
3 mL BAC + 1mg vial
3 mcg/unit
Daily Range
30–100 mcg Subcutaneous (SQ)
Daily
Standard Dose
50 mcg
Cycle
4–8 weeks
then reassess
IGF-1 LR3muscle growthprotein synthesisanabolic peptidetissue regeneration

Dosing & Reconstitution Guide

In preclinical studies, IGF-1 LR3 is used at 20–100 μg/kg depending on species and study design. These values do not translate to safe or approved human dosing.

Standard / Gradual Approach

1mg Vialstandard
PhaseDoseVolume
Week 1-220 mcg daily
Week 3-440 mcg daily
Week 5+60-80 mcg daily, cycle 4 weeks on / 4 weeks off

Protocol Summary

Subcutaneous (SQ): Daily · Dose range 30100 mcg with gradual titration
Cycle Length: 4–8 weeks typical; reassess before extending

Frequency & Cycling

SubQ Injection

Administer daily at 40–100 mcg post-exercise or in the morning. Suggested cycle: 4–6 weeks on, 4 weeks off to avoid receptor desensitization.

🧪 Quick Start

Vial Size
1 mg
BAC Water
3 mL
Concentration
0.33 mcg/unit
Starting Dose
20 mcg daily
Maintenance Dose
40-80 mcg daily

Potential Benefits & Use Cases

IGF-1 LR3 is not FDA-approved and is restricted to laboratory research use only.
Enhances anabolic signaling and protein synthesis via IGF-1R activation of PI3K/Akt and MAPK pathways (preclinical)
Extended bioavailability (20–30 hour half-life) compared to native IGF-1 (12–15 hours), ~3× more potent (preclinical)
Drives new muscle fiber development through satellite cell activation (hyperplasia) (preclinical)
Promotes glucose uptake and cellular proliferation through IGF-1R pathways (preclinical)
Clinical data Strong preclinical Limited data

Mechanism of Action

Binds to IGF-1 receptors to stimulate cellular proliferation and protein synthesis
Inhibits apoptosis and promotes muscle cell repair
Extended half-life reduces binding to IGFBPs, enhancing tissue absorption

Lifestyle & Optimization

timing

Post-workout injection preferred. Avoid injection around meals (insulin interference).

diet

High protein diet essential. Avoid high-carb meals around injection timing.

exercise

Heavy resistance training maximizes anabolic response.

sleep

Natural GH pulses during deep sleep synergize with exogenous IGF-1.

Side Effects & Safety

Common Side Effects

Hypoglycemia — shakiness, confusion, sweating, dizziness; always administer with food
Dose-dependent safety concerns above 50–60 mcg/day
Receptor desensitization after 6–8 weeks continuous use; cycling recommended (8 on/4–8 off)

🧮 Dose Calculator

Concentration
3.3
mcg/unit
Draw Volume
150
units (1.500 mL)
For a 500 mcg dose, draw 150 units on a U-100 insulin syringe
🧬

Bioavailability & Absorption

SubQ Injection
High; bypasses GI tract and avoids IGFBP binding due to LR3 modification
Oral Administration
Very low; degraded in digestive system
Half-Life
20–30 hours
Degradation
Processed by hepatic and renal clearance
Tissue Specificity
Targets skeletal muscle, cartilage, and bone growth sites
⚗️

Peptide Details

Molecular Weight
9111.6
Formula
C990H1528N262O300S7
Sequence
MFPAMPLSSLVLARLLINGNRGPEETLCGAELVDALQFVCGDRGFYFSRPASRPPPGSRPLPVMTLSRRQLAVGRVRYGLRLLGTPGD
⚖️

Legal Status & Regulatory

RegionStatus
FDANot Approved
EUNot Approved
AustraliaNot Approved
CanadaNot Approved

Storage Instructions

Lyophilized (Powder)
Store lyophilized powder at -20°C. Extremely temperature-sensitive. Must remain frozen until ready to reconstitute. Do not freeze reconstituted solution. Avoid repeated freeze-thaw cycles.
Reconstituted (Mixed)
Refrigerate at 2-8°C. Use within 2-3 weeks. Highly perishable.