Pepacorn
← Compounds

IGF-1 LR3

peptide · headlineResearch use only

Binds to IGF-1 receptors to stimulate cellular proliferation and protein synthesis

Overview

IGF-1 LR3 is a long-acting analog of insulin-like growth factor-1 engineered for enhanced bioavailability and prolonged action. It binds IGF-1 receptors in muscle and bone to stimulate anabolic growth, repair, and recovery. It is studied for its role in cell proliferation, muscle growth, and tissue regeneration in animal models and in vitro systems.

How it works

  • Binds to IGF-1 receptors to stimulate cellular proliferation and protein synthesis
  • Inhibits apoptosis and promotes muscle cell repair
  • Extended half-life reduces binding to IGFBPs, enhancing tissue absorption

Dosing

Typical dose: 50 mcg daily SubQ post-workout or in the morning. Cycle 4–6 weeks on, followed by 4 weeks off.

Subcutaneous (SQ)50 mcg standardrange 30100 mcg· Daily

Caution: In preclinical studies, IGF-1 LR3 is used at 20–100 μg/kg depending on species and study design. These values do not translate to safe or approved human dosing.

Cycling

  • Administer daily at 40–100 mcg post-exercise or in the morning. Suggested cycle: 4–6 weeks on, 4 weeks off to avoid receptor desensitization.

Side effects

Common
  • Hypoglycemia — shakiness, confusion, sweating, dizziness; always administer with food
  • Dose-dependent safety concerns above 50–60 mcg/day
  • Receptor desensitization after 6–8 weeks continuous use; cycling recommended (8 on/4–8 off)

Stacking & combinations

With

GHRP-2

Benefit

Enhanced GH secretion complements IGF-1 activity for greater anabolic effect

With

PEG MGF

Benefit

Supports synergistic repair and hypertrophy of muscle tissue

Lifestyle support

Diet

High protein diet essential. Avoid high-carb meals around injection timing.

Sleep

Natural GH pulses during deep sleep synergize with exogenous IGF-1.

Timing

Post-workout injection preferred. Avoid injection around meals (insulin interference).

Exercise

Heavy resistance training maximizes anabolic response.

Research studies

Studies summarized for educational purposes only. Inclusion does not imply human use; referenced research was conducted in vitro, in animal models, or in regulated clinical trials.

Research study

Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency

Francis GL, et al. J Mol Endocrinol. 1992;8(3):213-223. View source ↗

Scientific findings

This foundational study produced and characterized Long-[Arg3]-IGF-I (LR3), which combines a 13-residue N-terminal extension with a Glu3-to-Arg3 substitution. In cell lines that secrete IGF binding proteins (e.g., L6 myoblasts), LR3-IGF-I was substantially more potent than native IGF-I at stimulating protein synthesis, whereas in cells lacking detectable IGFBP secretion it was actually less potent, demonstrating that the enhanced biological potency derives from reduced IGFBP binding rather than increased affinity for the type 1 IGF receptor. The work established the mechanistic rationale that LR3's activity depends on escaping IGFBP sequestration to raise the free, receptor-available fraction.

Plain English

Researchers engineered the modified growth factor now called IGF-1 LR3 and tested it in cell cultures. It worked more strongly than ordinary IGF-1, but only in cells that release the carrier proteins that normally trap IGF-1; in cells without those carriers it was weaker. This showed that LR3's extra strength comes from avoiding being bound up by carrier proteins, not from binding the growth-factor receptor more tightly. The study was done entirely in cell culture, not in people.

Research study

Long R3 insulin-like growth factor-I (IGF-I) infusion stimulates organ growth but reduces plasma IGF-I, IGF-II and IGF binding protein concentrations in the guinea pig

Conlon MA, et al. J Endocrinol. 1995;146(2):247-253. View source ↗

Scientific findings

Continuous infusion of Long-R3-IGF-I in guinea pigs stimulated growth of specific organs (notably the spleen, kidney and gut) while paradoxically lowering circulating endogenous IGF-I, IGF-II and IGF binding protein concentrations, consistent with negative feedback suppression of the somatotropic axis. Because LR3 binds IGFBPs poorly, it distributes and acts differently from native IGF-I, driving tissue growth even as it depresses the endogenous IGF system. The findings illustrate both the anabolic organ-specific effects and the systemic feedback consequences of a poorly-IGFBP-bound analog in a live animal model.

Plain English

In guinea pigs, giving IGF-1 LR3 continuously made certain organs grow larger, but at the same time it lowered the animals' own natural IGF-1 and its carrier proteins in the blood. This suggests the body senses the extra activity and dials back its own production as a feedback response. It is an animal study that highlights both growth effects and the potential to disrupt the body's normal growth-factor balance.

Research study

Insulin-like growth factor I (IGF-I) and long R(3)IGF-I differently affect development and messenger ribonucleic acid abundance for IGF-binding proteins and type I IGF receptors in in vitro produced bovine embryos

Prelle K, et al. Endocrinology. 2001;142(3):1309-1316. View source ↗

Scientific findings

In in vitro-produced bovine embryos, native IGF-I and Long-R3-IGF-I exerted distinct effects on developmental competence and on mRNA abundance for IGF binding proteins and the type 1 IGF receptor, indicating that the two ligands are not interchangeable despite acting through the same receptor. The differences were attributed to LR3's reduced IGFBP binding, which alters local ligand availability and downstream transcriptional regulation of the IGF axis in developing embryos.

Plain English

When added to cattle embryos grown in the lab, ordinary IGF-1 and IGF-1 LR3 had different effects on how the embryos developed and on which growth-related genes were switched on. This means the modified version does not simply mimic natural IGF-1 even though they use the same receptor. The work is from reproductive and agricultural research, not human medicine.

Verified citations

2 · PubMed-checked
  • The emerging landscape of performance-enhancing peptides modulating GH-IGF1 axis.reviewPMID 42395176
  • Differential effects of IGF-I (LR3-IGF-I) and gonadotropins on granulosa cell proliferation.preclinicalPMID 11334915

Reconstitution calculator

Subcutaneous (SQ)
Draw to1 units

= 0.01 mL on a U-100 insulin syringe

Concentration5 mg/mL
Doses / vial200

Assumes a U-100 insulin syringe (100 units = 1 mL). This is a preparation aid, not a protocol — dose and route are the prescriber's decision. Refrigerate at 2-8°C. Use within 2-3 weeks. Highly perishable.

Chemistry & PK

Sequence
MFPAMPLSSLVLARLLINGNRGPEETLCGAELVDALQFVCGDRGFYFSRPASRPPPGSRPLPVMTLSRRQLAVGRVRYGLRLLGTPGD
Half Life
20–30 hours
Degradation
Processed by hepatic and renal clearance
Molecular Weight
9111.6
Molecular Formula
C990H1528N262O300S7
Tissue Specificity
Targets skeletal muscle, cartilage, and bone growth sites

Bioavailability

Oral
Very low; degraded in digestive system
Subq
High; bypasses GI tract and avoids IGFBP binding due to LR3 modification

Storage & handling

Lyophilized

Store lyophilized powder at -20°C. Extremely temperature-sensitive. Must remain frozen until ready to reconstitute. Do not freeze reconstituted solution. Avoid repeated freeze-thaw cycles.

Reconstituted

Refrigerate at 2-8°C. Use within 2-3 weeks. Highly perishable.

Legal / compounding

Research use only
EU
Not Approved
FDA
Not Approved
Canada
Not Approved
Australia
Not Approved

Legal status is a hard gate: non-compoundable or delisted agents cannot be filled and are blocked from protocol export. Keep 503A status current.