Semaglutide

Semaglutide is a long-acting GLP-1 receptor agonist peptide used for weight management and glycemic control. It reduces appetite and caloric intake while enhancing insulin secretion and delaying gastric emptying. Available as Ozempic (for diabetes) and Wegovy (for obesity), it is a proven tool in treating metabolic syndrome and aiding fat loss when combined with lifestyle interventions.

• GLP-1 receptor agonism: enhances insulin secretion, delays gastric emptying, reduces appetite
• Suppresses glucagon secretion
• Acts on brain centers regulating appetite and satiety

• unit: mg

  low dose: 0.25

  frequency: Once weekly

  high dose: 2.4

  standard dose: 1

  administration route: Subcutaneous (SQ)

• Typical protocol: 0.25 mg/week for 4 weeks → 0.5 mg → 1 mg → 1.7 mg → 2.4 mg. Duration 12–24 weeks. Break for 4–6 weeks between cycles.

common: ["GI effects: nausea, vomiting, diarrhea, constipation — decrease with gradual titration","Hypoglycemia risk when combined with insulin or sulfonylureas"]

warnings: ["Rare: pancreatitis, gallbladder disease, acute kidney injury","Thyroid C-cell tumors observed in rodents (human relevance uncertain)"]

sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

half life: Approximately 1 week

degradation: Enzymatic degradation and renal clearance

molecular weight: 4113.58

molecular formula: C187H291N45O59

tissue specificity: Acts on pancreatic beta cells, CNS appetite centers, liver, and GI tract

• Wegovy (semaglutide): a new weight loss drug for chronic weight management.clinicalPMID 34706925 ↗
• The Discovery and Development of Liraglutide and Semaglutide.mechanismPMID 31031702 ↗
• Safety of Semaglutide.reviewPMID 34305810 ↗